pLVML- 3*Flag- MCS- IRES- Puro

https://www.gentaur.be/web/image/product.template/1996/image_1920?unique=2e46eb6

318,00 € 318.0 EUR 318,00 €

318,00 €

Not Available For Sale

    Deze combinatie bestaat niet.

    Terms and Conditions
    30-dagen geld terug garantie
    Verzending: 2-3 werkdagen

    pLVML- 3*Flag- MCS- IRES- Puro

    PVT11064  2ug

     

    pLVML- 3*Flag- MCS- IRES- Puro Informaiton

    Prokaryotic resistance: ampicillin Amp

    Screening Marker: Puromycin Puro

    Cloning strain: Escherichia coli Stbl3

    Culture conditions: 37 C

     

    pLVML- 3*Flag- MCS- IRES- Puro Multiple cloning site

     

     

    pLVML- 3*Flag- MCS- IRES- Puro Sequence

    LOCUS       Exported                8215 bp ds-DNA     circular SYN 01-DEC-2017DEFINITION  synthetic circular DNAFEATURES             Location/Qualifiers     source          1..8215                     /organism="synthetic DNA construct"                     /mol_type="other DNA"     LTR             1..634                     /label=3' LTR                     /note="3' long terminal repeat (LTR) from HIV-1"     misc_feature    681..806                     /label=HIV-1 Psi                     /note="packaging signal of human immunodeficiency virus                      type 1"     misc_feature    1303..1536                     /label=RRE                     /note="The Rev response element (RRE) of HIV-1 allows for                      Rev-dependent mRNA export from the nucleus to the                      cytoplasm."     misc_feature    2028..2143                     /label=cPPT/CTS                     /note="central polypurine tract and central termination                      sequence of HIV-1 (lacking the first T)"     enhancer        2201..2504                     /label=CMV enhancer                     /note="human cytomegalovirus immediate early enhancer"     promoter        2505..2708                     /label=CMV promoter                     /note="human cytomegalovirus (CMV) immediate early                      promoter"     regulatory      2809..2818                     /regulatory_class="other"                     /note="vertebrate consensus sequence for strong initiation                      of translation (Kozak, 1987)"     CDS             2818..2883                     /codon_start=1                     /product="three tandem FLAG(R) epitope tags, followed by an                     enterokinase cleavage site"                     /label=3xFLAG                     /translation="DYKDHDGDYKDHDIDYKDDDDK"     misc_feature    2884..2915                     /label=MCS     misc_feature    2918..3491                     /label=IRES                     /note="internal ribosome entry site (IRES) of the                      encephalomyocarditis virus (EMCV)"     CDS             3524..4123                     /codon_start=1                     /gene="pac from Streptomyces alboniger"                     /product="puromycin N-acetyltransferase"                     /label=PuroR                     /note="confers resistance to puromycin"                     /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER                     VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA                     AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS                     APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA"     misc_feature    4137..4725                     /label=WPRE                     /note="woodchuck hepatitis virus posttranscriptional                      regulatory element"     LTR             4932..5565                     /label=3' LTR                     /note="3' long terminal repeat (LTR) from HIV-1"     rep_origin      complement(6095..6683)                     /direction=LEFT                     /label=ori                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of                      replication"     CDS             complement(6854..7714)                     /codon_start=1                     /gene="bla"                     /product="beta-lactamase"                     /label=AmpR                     /note="confers resistance to ampicillin, carbenicillin, and                     related antibiotics"                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS                     LIKHW"     promoter        complement(7715..7819)                     /gene="bla"                     /label=AmpR promoter     polyA_signal    7867..8001                     /label=SV40 poly(A) signal                     /note="SV40 polyadenylation signal"ORIGIN        1 tggaagggct aattcactcc caaagaagac aagatatcct tgatctgtgg atctaccaca       61 cacaaggcta cttccctgat tagcagaact acacaccagg gccaggggtc agatatccac      121 tgacctttgg atggtgctac aagctagtac cagttgagcc agataaggta gaagaggcca      181 ataaaggaga gaacaccagc ttgttacacc ctgtgagcct gcatgggatg gatgacccgg      241 agagagaagt gttagagtgg aggtttgaca gccgcctagc atttcatcac gtggcccgag      301 agctgcatcc ggagtacttc aagaactgct gatatcgagc ttgctacaag ggactttccg      361 ctggggactt tccagggagg cgtggcctgg gcgggactgg ggagtggcga gccctcagat      421 cctgcatata agcagctgct ttttgcctgt actgggtctc tctggttaga ccagatctga      481 gcctgggagc tctctggcta actagggaac ccactgctta agcctcaata aagcttgcct      541 tgagtgcttc aagtagtgtg tgcccgtctg ttgtgtgact ctggtaacta gagatccctc      601 agaccctttt agtcagtgtg gaaaatctct agcagtggcg cccgaacagg gacttgaaag      661 cgaaagggaa accagaggag ctctctcgac gcaggactcg gcttgctgaa gcgcgcacgg      721 caagaggcga ggggcggcga ctggtgagta cgccaaaaat tttgactagc ggaggctaga      781 aggagagaga tgggtgcgag agcgtcagta ttaagcgggg gagaattaga tcgcgatggg      841 aaaaaattcg gttaaggcca gggggaaaga aaaaatataa attaaaacat atagtatggg      901 caagcaggga gctagaacga ttcgcagtta atcctggcct gttagaaaca tcagaaggct      961 gtagacaaat actgggacag ctacaaccat cccttcagac aggatcagaa gaacttagat     1021 cattatataa tacagtagca accctctatt gtgtgcatca aaggatagag ataaaagaca     1081 ccaaggaagc tttagacaag atagaggaag agcaaaacaa aagtaagacc accgcacagcThere are currently no product reviews.
     Write Review