Se rendre au contenu

Recombinant Human Growth/differentiation factor 9 (GDF9), Expression: E.coli, Tag: N-terminal GST, 20 ug

https://www.gen.bg/web/image/product.template/5784/image_1920?unique=325b45d
(0 avis)

0,00 € 0.0 EUR 0,00 € Hors taxes

info@gentaur.com

    Cette combinaison n'existe pas.

    Conditions générales
    Garantie satisfait ou remboursé de 30 jours
    Expédition : 2-3 jours ouvrables

    Purity: Greater than 90% as determined by SDS-PAGE.

    Target Names: GDF9

    Uniprot No: O60383

    Research Area: Cardiovascular

    Alternative Names: GDF9Growth/differentiation factor 9; GDF-9

    Species: Homo sapiens (Human)

    Expression system: E.coli

    Expression Region: 320-454aa

    Protein Sequence: GQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR

    Mol. Weight: 42.5kDa
    Protein Length: Full Length of Mature Protein
    Tag Info: N-terminal GST-tagged


    (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel: