Se rendre au contenu

Recombinant Human Protein flightless-1 homolog (FLII), partial, E.coli expression - 2 mg

https://www.gen.bg/web/image/product.template/19581/image_1920?unique=325b45d
(0 avis)

Uniprot: Q13045
Expression Region: 495-827aa (partial)
Tag: N-terminal 10xHis-tag and C-terminal Myc-tag

0,00 € 0.0 EUR 0,00 € Hors taxes

info@gentaur.com

    Cette combinaison n'existe pas.

    Conditions générales
    Garantie satisfait ou remboursé de 30 jours
    Expédition : 2-3 jours ouvrables

    Uniprot: Q13045

    Expression Region: 495-827aa (partial)

    Tag: N-terminal 10xHis-tag and C-terminal Myc-tag

    Target Protein Sequence:

    VGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGTSLDPRFVFLLDRGLDIYVWRGAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWEALGGEPSEIKKHVPEDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKQRPKVELMPRMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAAAEQKLISEEDL