Recombinant SARS-CoV-2 Pirola variant Spike glycoprotein (S), partial, E.coli expression - 1 mg

https://www.gen.bg/web/image/product.template/8182/image_1920?unique=bd4f7c5

1,722.00 € 1722.0 EUR 1,722.00 €

1,722.00 €

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days

    Type: Recombinant protein

    Expression system: E. coli

    Species: SARS-CoV-2, Pirola variant

    Tag: Will be determined during production. If you have a specific tag requirement, please let us know and will try to use your tag of preference. Tag removal service is also available.

    Expression Region: 315-535 aa

    Target Protein Sequence (The complete sequence will be provided upon request, including tag sequence, target protein sequence and linker sequence):

    TSNFRVQPTESIVRFPNVTNLCPFHEVFNATRFASVYAWNRTRISNCVADYSVLYNLAPFFTFKCYGVSPTKLNDLCFTNVYADSFVIKGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKHSGNYDYMYRLFRKSKLKPFERDISTEIYQAGNKPCKGKGPNCYFPLQSYSFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVK