Overslaan naar inhoud
info@gentaur.com 0.0 EUR
Anti-Prion, clone 1E4, neat - 125µg/250µl
M1839
Clone 1E4
This clone was derived from hybridization of SP2/0-Ag14 myeloma cells with
spleen cells of a mouse immunized with the peptide QWNKPSKPKTN#
(corresponding to the bovine PrP AA sequence 108-119; #=amidated carboxyterminus) coupled to KLH at its N-terminal end via a CG-AA linker.
Isotype IgG1κ
info@gentaur.com 0.0 EUR
info@gentaur.com 0.0 EUR
info@gentaur.com 0.0 EUR
info@gentaur.com 0.0 EUR
info@gentaur.com 0.0 EUR
info@gentaur.com 0.0 EUR
Avian Influenza Virus H5 Antigen rapid tests kit - 40 tests/kit
Assay type: Qualitative Sandwich Lateral Flow
Sensitivity: 98.3%
Specificity: 99.3%
Assay time: 10 minutes
Sample types: Trachea and Cloacal orifice secretions
info@gentaur.com 0.0 EUR
Avian Influenza Virus H7 Antigen rapid tests kit - 40 tests/kit
Assay type: Qualitative Sandwich Lateral Flow
Sensitivity: 98.7%
Specificity: 99.7%
Assay time: 10 minutes
Sample types: Trachea and Cloacal orifice secretions
info@gentaur.com 0.0 EUR
Avian Influenza Virus H9 Antigen rapid tests kit - 40 Tests/kit
Assay type: Qualitative Sandwich Lateral Flow
Sensitivity: 98.3%
Specificity: 99.3%
Assay time: 10 minutes
Sample types: Trachea and Cloacal orifice secretions
info@gentaur.com 0.0 EUR
info@gentaur.com 0.0 EUR
info@gentaur.com 0.0 EUR
info@gentaur.com 0.0 EUR
info@gentaur.com 0.0 EUR
info@gentaur.com 0.0 EUR
info@gentaur.com 0.0 EUR
info@gentaur.com 0.0 EUR
info@gentaur.com 0.0 EUR
info@gentaur.com 0.0 EUR
info@gentaur.com 0.0 EUR
info@gentaur.com 0.0 EUR
info@gentaur.com 0.0 EUR
Bacillus anthracis Protective antigen (PagA) IgG ELISA kit - 96-wells plate
Assay type: Sandwich ELISA
Assay principle: Coated antigen PA83 -> Anti-PA83 IgG bind to the coated antigen -> HRP-labeled protein G binds to the IgG
Standard/Control: Rabbit Anti-PA83 IgG
*Note: The interaction between Protein G and IgG is not species specific
info@gentaur.com 0.0 EUR
Bacillus thuringiensis subsp. sotto Pesticidal crystal protein Cry14Aa (Uniprot: Q45710), partial (61-313aa), E.coli expression - up to 1 mg (exact amount to be determined after purification)
Protein sequence:
GAFNYLTLLQSGISLAGSFVPGGTFVAPIVNMVIGWLWPHKNKTADTENLIKLIDEEIQKQLNKALLDQDRNNWTSFLESIFDTSATVSNAIIDAQWSGTVD
TTNRQQKTPTTSDYLNVVGKFDSADSSIITNENQIMNGNFDVAAAPYFVIGATLRLSLYQSYIKFCNSWIDAVGFSTNDANTQKANLARTKLTMRTTINEYT
QRVMKVFKDSKNMPTIGTNKFSVDAYNVYVKGMTLNVLDMVAIWSSLYP
info@gentaur.com 0.0 EUR