Sequence (5' to 3'):
GTCTTAAGGTGGGCTGGGTG

Sequence (5' to 3'):
CCCCGAATCTCATTGATCAGC

Sequence (5' to 3'):
FAM-AGCGAACCATTGGTATCGGACGTT-TAMRA

Maintenance freeze medium for bacterial cultures storage.

Guaranteed Deliverables:

1.      200ug antigen (used as positive control);
2.      25ul pre-immune serum (used as negative control);
3.      100ul mouse ascites fluid;
4.      Monoclonal antibodies purified from 10ml mouse ascites fluid by Protein A/G;

Antigen Uniprot ID: A0JD37

Antigen Sequences:
DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVIS
PVRTEDSATYYCAF

Guaranteed Deliverables:
1. 200ug * antigen (used as positive control);
2. 25ul * Pre-immune serum (used as negative control);
3. 100ul mouse ascites fluid;
4. 5mg * Biotin conjugated monoclonal antibodies purified by Protein A/G;

Guaranteed Quality:
1. Titer of immune serum can be guaranteed 1: 10000 through in-direct ELISA before purification.
2. Antibody purity can be guaranteed above 90% by SDS-PAGE detection.
3. Antibody can be guaranteed to specifically recognize antigen through western blot assay (not available if antigen is peptide).

Lead time: ~24-32 weeks

Antigen Uniprot ID: A0JD37

Antigen Sequences:
DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVIS
PVRTEDSATYYCAF

Guaranteed Deliverables:
1. 200ug * antigen (used as positive control);
2. 25ul * Pre-immune serum (used as negative control);
3. 100ul mouse ascites fluid;
4. 5mg * FITC conjugated monoclonal antibodies purified by Protein A/G;

Guaranteed Quality:
1. Titer of immune serum can be guaranteed 1: 10000 through in-direct ELISA before purification.
2. Antibody purity can be guaranteed above 90% by SDS-PAGE detection.
3. Antibody can be guaranteed to specifically recognize antigen through western blot assay (not available if antigen is peptide).

Lead time: ~24-32 weeks

Immunogen sequence: MGVKFFTLSTRFFPSVQRAVPLWTNS + KLH and BSA through Cys at the C terminal

Deliverables:
1) 10ml of ProteinA/G affinity purified antibody (concentration 1mg/ml).
*The purity of the antibody is at least 90% (SDS-PAGE test), and the antibody titer in the ELISA titer test is at least 1:64000
2) 100ug of each peptide (immunogen) conjugate
3) 1ml of pre-immune serum and indirect ELISA test results

Lead time: ~70 business days

Immunogen sequence: MGVKFFTLSTRFFPSVQRAVPLWTNS + KLH and BSA through Cys at the C terminal

Deliverables:
1) 1mg of antigen affinity chromatography purification purified antibody (concentration 1mg/ml).
*The purity of the antibody is at least 90% (SDS-PAGE test), and the antibody titer in the ELISA titer test is at least 1:64000
2) 100ug of each peptide (immunogen) conjugate
3) 1ml of pre-immune serum and indirect ELISA test results

Lead time: ~70 business days