Overslaan naar inhoud
Price List Default - EUR
Sorteren op: Naam (A-Z)
Arginine (Arg) ELISA Kit - 96-wells plate
info@gentaur.com 0.0 EUR
Arginine ELISA kit - 96-wells plate
info@gentaur.com 0.0 EUR
Arp2/3 Protein Complex (Porcine brain) - 2x 50 ug
info@gentaur.com 0.0 EUR
Arthrogen-CIA: Arthritogenic Monoclonal Antibody 5-Clone Cocktail Kit - 100 mg
info@gentaur.com 0.0 EUR
Arthrogen-CIA® 5-Clone Cocktail Kit - 10 mg
info@gentaur.com 0.0 EUR
Arthrogen-CIA® 5-Clone Cocktail Kit - 40 mg
info@gentaur.com 0.0 EUR
Arylesterase/Paraoxonase Assay Kit (200 tests)
info@gentaur.com 0.0 EUR
AsPc-1 cell line - 1 vial
info@gentaur.com 0.0 EUR
Assay Plates (PS), 96 Round Well Flat-Bottom, Natural, 14.10mm Height, 340µL, Non-Sterile - 10 Plates/Pack, 10 Packs/Case (100 plates total)
info@gentaur.com 0.0 EUR
AutoMATE™ 96 Microplate Pipetting Workstation, 230V (head not included) - 1 unit
info@gentaur.com 0.0 EUR
AutoMATE™ Pipette tips, racked 96 well, 1000ul Low Retention - 16racks/case
info@gentaur.com 0.0 EUR
AutoMATE™ Pipette tips, racked 96 well, 200ul Low Retention - 24 racks/case
info@gentaur.com 0.0 EUR
AutoMATE™ Pipette tips, racked 96 well, 20ul Low Retention - 24 racks/case
info@gentaur.com 0.0 EUR
AutoMATE™ Reagent reservoir, 195mL - 1 unit
info@gentaur.com 0.0 EUR
AutoMATE™ STERILE Pipette tips, racked 96 well, 1000ul Filtered, Low Retention - 16 racks/case
info@gentaur.com 0.0 EUR
AutoMATE™ STERILE Pipette tips, racked 96 well, 200ul Filtered, Low Retention - 24 racks/case
info@gentaur.com 0.0 EUR
AutoMATE™ STERILE Pipette tips, racked 96 well, 20ul Filtered, Low Retention - 24 racks/case
info@gentaur.com 0.0 EUR
Autophagy ELISA Kit (LC3-II Quantitation) 96Т
info@gentaur.com 0.0 EUR
Avian Influenza H5 Antibody ELISA Kit, AIV H5 Ab ELISA Kit - 96 wells plate
info@gentaur.com 0.0 EUR
Avian Influenza H7 Antibody ELISA Kit, AIV H7 Ab ELISA Kit - 96 wells plate
info@gentaur.com 0.0 EUR
Avian Influenza H9 Antibody ELISA Kit, AIV H9 Ab ELISA Kit - 96 wells plate
info@gentaur.com 0.0 EUR
Avian Influenza Virus H5 Antigen rapid tests kit - 40 tests/kit
Assay type: Qualitative Sandwich Lateral Flow
Sensitivity: 98.3%
Specificity: 99.3%
Assay time: 10 minutes
Sample types: Trachea and Cloacal orifice secretions
info@gentaur.com 0.0 EUR
Avian Influenza Virus H5 Subtype Antibody (AIV-H5 Ab) ELISA Kit (Qualitative) - 96-wells plate
info@gentaur.com 0.0 EUR
Avian Influenza Virus H7 Antigen rapid tests kit - 40 tests/kit
Assay type: Qualitative Sandwich Lateral Flow
Sensitivity: 98.7%
Specificity: 99.7%
Assay time: 10 minutes
Sample types: Trachea and Cloacal orifice secretions
info@gentaur.com 0.0 EUR
Avian Influenza Virus H9 Antigen rapid tests kit - 40 Tests/kit
Assay type: Qualitative Sandwich Lateral Flow
Sensitivity: 98.3%
Specificity: 99.3%
Assay time: 10 minutes
Sample types: Trachea and Cloacal orifice secretions
info@gentaur.com 0.0 EUR
Avian Leukosis Virus (ALV, subgroups A, B, C, D, E) Real Time RT-PCR Kit - 50 reactions
info@gentaur.com 0.0 EUR
Avian Toxoplasma gondii Antibody (Toxo-Ab) ELISA Kit - 96 Tests
info@gentaur.com 0.0 EUR
Avian poxvirus One step PCR - 100 Reactions
info@gentaur.com 0.0 EUR
Avidin Polystyrene Particles, 5.0%w/v, 1.0-1.9µm - 10 mL
info@gentaur.com 0.0 EUR
Azoxystrobin Antigen - 1 mg
info@gentaur.com 0.0 EUR
B.TB Ab ELISA 2.0 (480Wells/KIT)
info@gentaur.com 0.0 EUR
BACE1 Activity Assay Kit (Fluorometric) - 96 wells
info@gentaur.com 0.0 EUR
BGP-15 (CAS# 66611-37-8), PARP inhibitor - 5 mg
info@gentaur.com 0.0 EUR
BHI Agar Slants - 25 slants
info@gentaur.com 0.0 EUR
BHI Broth - 25x 5mL
info@gentaur.com 0.0 EUR
BLOCK ACE Accessory Reagent - 20 x 40 g
info@gentaur.com 0.0 EUR
BMAA (β-N-methylamino-L-alanine) ELISA kit - 96-wells plate
info@gentaur.com 0.0 EUR
BPC-157 Pentadecapeptide - 5 mg
info@gentaur.com 0.0 EUR
BS168 Bacillus subtilis Strain - 100 µL
info@gentaur.com 0.0 EUR
BSA (Bovine Serum Albumin) ELISA Kit - 96-wells plate
info@gentaur.com 0.0 EUR
BSA Conjugated Arginine (BSA-Arg) - 200 ug
info@gentaur.com 0.0 EUR
BSA Conjugated Arginine (BSA-Arg) - 50 ug
info@gentaur.com 0.0 EUR
BSA conjugated Abscisic acid - 1 mg
info@gentaur.com 0.0 EUR
BSE (Bovine Spongiform Encephalopathy) test kit II - 96-wells plate
info@gentaur.com 0.0 EUR
BT-20 cells (breast tumor cell line) - 1 mL vial (~1.3x10^6 cells/mL)
info@gentaur.com 0.0 EUR
BTC, AM (CAS 176767-94-5) - 1 mg
info@gentaur.com 0.0 EUR
BW25113 Escherichia coli Strain - 100 µL
info@gentaur.com 0.0 EUR
Babesia bigemina PCR primer (forward) - 100 nmol (Lyophilized)
Sequence:
TACTGTGACGAGGACGGATC
info@gentaur.com 0.0 EUR
Babesia bigemina PCR primer (reverse) - 100 nmol (Lyophilized)
Sequence:
CCTCAAAAGCAGATTCGGAGT
info@gentaur.com 0.0 EUR
Babesia bovis Nested PCR primer (1st forward) - 100 nmol (Lyophilized)
Sequence:
CACGAGCAAGGAACTACCGATGTTGA
info@gentaur.com 0.0 EUR
Babesia bovis Nested PCR primer (1st reverse) - 100 nmol (Lyophilized)
Sequence:
CCAAGGACCTTCAACGTACGAGGTCA
info@gentaur.com 0.0 EUR
Babesia bovis Nested PCR primer (2nd forward) - 100 nmol (Lyophilized)
Sequence:
TCAACAAGGTACTCTATATGGCTACC
info@gentaur.com 0.0 EUR
Babesia bovis Nested PCR primer (2nd reverse) - 100 nmol (Lyophilized)
Sequence:
CTACCGAGCAGAACCTTCTTCACCAT
info@gentaur.com 0.0 EUR
Babesia equi One-Step PCR - 100 Reactions
info@gentaur.com 0.0 EUR
Babesia equi One-Step PCR - 150 Reactions
info@gentaur.com 0.0 EUR
Babesia equi One-Step PCR - 50 Reactions
info@gentaur.com 0.0 EUR
Baby Rabbit Complement - 100 mL
info@gentaur.com 0.0 EUR
Bacillus anthracis Protective antigen (PagA) IgG ELISA kit - 96-wells plate
Assay type: Sandwich ELISA
Assay principle: Coated antigen PA83 -> Anti-PA83 IgG bind to the coated antigen -> HRP-labeled protein G binds to the IgG
Standard/Control: Rabbit Anti-PA83 IgG
*Note: The interaction between Protein G and IgG is not species specific
info@gentaur.com 0.0 EUR
Bacillus thuringiensis subsp. sotto Pesticidal crystal protein Cry14Aa (Uniprot: Q45710), partial (61-313aa), E.coli expression - up to 1 mg (exact amount to be determined after purification)
Protein sequence:
GAFNYLTLLQSGISLAGSFVPGGTFVAPIVNMVIGWLWPHKNKTADTENLIKLIDEEIQKQLNKALLDQDRNNWTSFLESIFDTSATVSNAIIDAQWSGTVD
TTNRQQKTPTTSDYLNVVGKFDSADSSIITNENQIMNGNFDVAAAPYFVIGATLRLSLYQSYIKFCNSWIDAVGFSTNDANTQKANLARTKLTMRTTINEYT
QRVMKVFKDSKNMPTIGTNKFSVDAYNVYVKGMTLNVLDMVAIWSSLYP
info@gentaur.com 0.0 EUR
Bacitracin - 25 grams (≥ 65IU/mg)
info@gentaur.com 0.0 EUR
Background buster (Ready-To-Use) - 125 mL
info@gentaur.com 0.0 EUR
Bacteria Genomic DNA extraction Kit (Magnetic Beads Based) - 100 extractions
info@gentaur.com 0.0 EUR
Bacterial DNA Extraction Kit (Magnetic Beads) - 100 extractions
info@gentaur.com 0.0 EUR
Bacterial DNA Extraction kit - 200 extractions
info@gentaur.com 0.0 EUR
Bacterial DNA Extraction kit - 50 extractions
info@gentaur.com 0.0 EUR
Bacteriophage MS2 RT-PCR Detection - 50 reactions
info@gentaur.com 0.0 EUR
Bacteriophage MS2: Escherichia Coli DNA - Medium (1 EA = 1 mL)
info@gentaur.com 0.0 EUR
Baker's yeast replication factor A (RFA) antibody - 50 uL
info@gentaur.com 0.0 EUR
Batson’s #17 Anatomical Corrosion Kit - 1 kit
info@gentaur.com 0.0 EUR
BbsI Linearized iLenti siRNA Vector - 25 ul
info@gentaur.com 0.0 EUR
Beta-Nicotinamide adenine dinucleotide - 5 grams
info@gentaur.com 0.0 EUR
Beta-glucuronidase (bovine liver) - 100 KU
info@gentaur.com 0.0 EUR
Bifidobacterium animalis (≥10 billion CFU/g) Freeze Dried Powder - 5 kg
info@gentaur.com 0.0 EUR
Bifidobacterium infantis (≥10 billion CFU/g) Freeze Dried Powder - 5 kg
info@gentaur.com 0.0 EUR
Bile Esculin Agar - 500 g
info@gentaur.com 0.0 EUR
BioChromato C1 Bump-Free Smart Evaporator (220V) - 1 unit
info@gentaur.com 0.0 EUR
BioMag®Plus Concanavalin A - 3mL
info@gentaur.com 0.0 EUR
BioTillt 25 (BT25) Bundle - 1 unit
Includes:
1x BioTilt™ System with WiFi controller setup

25 Biocoupler™ units with 8 oz or 16 oz jars
or
20 Biocoupler™ units with 32 oz jars
info@gentaur.com 0.0 EUR
Biotin Polystyrene Particles, 1%w/v, 6.0-8.0µm - 5mL
info@gentaur.com 0.0 EUR
Biotin Polystyrene Particles, Crosslinked, 1%w/v, 6.0-8.0µm - 5mL
info@gentaur.com 0.0 EUR
Biotin dT - 50 nmol scale
info@gentaur.com 0.0 EUR
Biotin-Linked Polyclonal Antibody to Somatostatin (SST) - 100 ul
info@gentaur.com 0.0 EUR
Biotin-PEG-SVA, 3.4 kDa - 5 grams
info@gentaur.com 0.0 EUR
Biotinylated Human ENPP-1 Protein, His-Avi Tag - 100 ug
info@gentaur.com 0.0 EUR
Biotinylated Recombinant Human CD79B Protein - 100 ug
info@gentaur.com 0.0 EUR
Bird Interferon gamma (IFN-γ) ELISA Kit - 96 wells plate
info@gentaur.com 0.0 EUR
Bird Interleukin 1 beta (IL-1B) ELISA Kit - 96 wells plate
info@gentaur.com 0.0 EUR
Bird Interleukin 6 (IL-6) ELISA Kit - 96 wells plate
info@gentaur.com 0.0 EUR
BlasTaq™ 2X qPCR MasterMix - 500 Reactions (4 x 1.25 mL)
info@gentaur.com 0.0 EUR
Blocking One (blocking buffer for immunoassays) - 500 mL
info@gentaur.com 0.0 EUR
Blocking One Histo - 50 mL
info@gentaur.com 0.0 EUR
Blood/Cell/Tissue Genomic DNA Extraction Kit (spin columns) - 200 extractions
info@gentaur.com 0.0 EUR
Blood/Cell/Tissue Genomic DNA Extraction Kit (spin columns) - 50 extractions
info@gentaur.com 0.0 EUR
Bluo-Gal (5-Bromo-3-indolyl β-D-galactopyranoside) - 100 mg
info@gentaur.com 0.0 EUR
Bordetella bronchiseptica Real Time PCR kit - 100 reactions
info@gentaur.com 0.0 EUR
Bordetella bronchiseptica Real Time PCR kit - 150 reactions
info@gentaur.com 0.0 EUR
Bovine Anthrax Antibody (Anthrax-Ab) ELISA Kit (Qualitative) - 96-wells plate
info@gentaur.com 0.0 EUR
Bovine Contagious bovine pleuropneumonia (CBPP) antibodies ELISA Kit - 48 wells plate
info@gentaur.com 0.0 EUR
Bovine Contagious bovine pleuropneumonia (CBPP) antibodies ELISA Kit - 96 wells plate
info@gentaur.com 0.0 EUR
Bovine Desmosine (DES) ELISA Kit - 96 wells plate
info@gentaur.com 0.0 EUR