Recombinant Proteins

[0338-APL917Hu02-200UG] Active Human Semaphorin 3A (SEMA3A) - 200 ug

Active Human Semaphorin 3A (SEMA3A) - 200 ug

[0338-Q45710-CUSTOM] Bacillus thuringiensis subsp. sotto Pesticidal crystal protein Cry14Aa (Uniprot: Q45710), partial (61-313aa), E.coli expression - up to 1 mg (exact amount to be determined after purification)

Bacillus thuringiensis subsp. sotto Pesticidal crystal protein Cry14Aa (Uniprot: Q45710), partial (61-313aa), E.coli expression - up to 1 mg (exact amount to be determined after purification)

Protein sequence:
GAFNYLTLLQSGISLAGSFVPGGTFVAPIVNMVIGWLWPHKNKTADTENLIKLIDEEIQKQLNKALLDQDRNNWTSFLESIFDTSATVSNAIIDAQWSGTVD
TTNRQQKTPTTSDYLNVVGKFDSADSSIITNENQIMNGNFDVAAAPYFVIGATLRLSLYQSYIKFCNSWIDAVGFSTNDANTQKANLARTKLTMRTTINEYT
QRVMKVFKDSKNMPTIGTNKFSVDAYNVYVKGMTLNVLDMVAIWSSLYP

[1015-93785ES60] Biotinylated Human ENPP-1 Protein, His-Avi Tag - 100 ug

Biotinylated Human ENPP-1 Protein, His-Avi Tag - 100 ug

[0544-MBS8248775-0.01MG] Chymotrypsin-Like Elastase Family Member 3a Preproprotein (CELA3A) Human Recombinant Protein - 0.01 mg

Chymotrypsin-Like Elastase Family Member 3a Preproprotein (CELA3A) Human Recombinant Protein - 0.01 mg

[0544-MBS8248775-0.05MG] Chymotrypsin-Like Elastase Family Member 3a Preproprotein (CELA3A) Human Recombinant Protein - 0.05 mg

Chymotrypsin-Like Elastase Family Member 3a Preproprotein (CELA3A) Human Recombinant Protein - 0.05 mg

[0804-HY-P2902-5MG] Glucose oxidase - 5 mg

Glucose oxidase - 5 mg

[0544-MBS1114902-E.COLI-0.02MG] Glutamyl endopeptidase (gseA) Recombinant Protein, E.coli expression - 0.02 mg

Glutamyl endopeptidase (gseA) Recombinant Protein, E.coli expression - 0.02 mg

[0992-HA211022-100UG] Human Recombinant Myeloperoxidase (MPO), HEK293 expression, Tag Free - 100 ug

Human Recombinant Myeloperoxidase (MPO), HEK293 expression, Tag Free - 100 ug

[0247-OPNB00036-100UG] Oropouche Virus Gn Protein, C-Fc tag, HEK293 expression - 100 ug

Oropouche Virus Gn Protein, C-Fc tag, HEK293 expression - 100 ug

[0787-E1350-01] RNase A (DNase-free) - 10 mg (1 mL)

RNase A (DNase-free) - 10 mg (1 mL)

[1012-HBP000406] RNase Inhibitor (40U/μL) - 1 mL

RNase Inhibitor (40U/μL) - 1 mL

[0399-CSB-EP002358BRB1-100UG] Recombinant Alkalihalophilus pseudofirmus ATP synthase subunit b (atpF), partial (30-163aa), E.coli expression - 100 ug

Recombinant Alkalihalophilus pseudofirmus ATP synthase subunit b (atpF), partial (30-163aa), E.coli expression - 100 ug

[0399-CSB-CF002358BRB-100UG] Recombinant Alkalihalophilus pseudofirmus ATP synthase subunit b (atpF), partial (30-163aa), in-vitro E.coli expression - 100 ug

Recombinant Alkalihalophilus pseudofirmus ATP synthase subunit b (atpF), partial (30-163aa), in-vitro E.coli expression - 100 ug

[0399-CSB-EP853125AJAT-100UG] Recombinant Aphanizomenon baltica Polyphosphate kinase (ppk), Full Length (1-387aa), E.coli expression - 100 ug

Recombinant Aphanizomenon baltica Polyphosphate kinase (ppk), Full Length (1-387aa), E.coli expression - 100 ug

[0399-CSB-EP853125AJAT-20UG] Recombinant Aphanizomenon baltica Polyphosphate kinase (ppk), Full Length (1-387aa), E.coli expression - 20 ug

Recombinant Aphanizomenon baltica Polyphosphate kinase (ppk), Full Length (1-387aa), E.coli expression - 20 ug

[0399-CSB-EP638761DLU-100UG] Recombinant Drosophila melanogaster Semaphorin-2A (Sema2a), partial (26-525aa), E. coli expression - 100 ug

Recombinant Drosophila melanogaster Semaphorin-2A (Sema2a), partial (26-525aa), E. coli expression - 100 ug

[0501-RFL7748HF] Recombinant Full Length Human Integrin Beta-6(Itgb6) Protein, His-Tagged - 100 ug

Recombinant Full Length Human Integrin Beta-6(Itgb6) Protein, His-Tagged - 100 ug

[0763-PKSH034166-20UG] Recombinant Human Activin B protein (His Tag) - 20 ug

Recombinant Human Activin B protein (His Tag) - 20 ug

[1015-92129ES60] Recombinant Human BDNF Protein, Flag tag - 100 ug

Recombinant Human BDNF Protein, Flag tag - 100 ug

[1015-92129ES76] Recombinant Human BDNF Protein, Flag tag - 500 ug

Recombinant Human BDNF Protein, Flag tag - 500 ug

[0035-ENZ-1119-50UG] Recombinant Human Beta-Secretase 1 (BACE1) - 50ug

Recombinant Human Beta-Secretase 1 (BACE1) - 50ug

[0399-CSB-EP861191HU-100ug] Recombinant Human Forkhead box protein P3 (FOXP3) - 100 ug

Recombinant Human Forkhead box protein P3 (FOXP3) - 100 ug

[0399-CSB-MP011890HU1-1MG] Recombinant Human Integrin beta-6 (ITGB6), partial (22-707aa), Mammalian cells expression, C-10xHis-tag - 1 mg

Recombinant Human Integrin beta-6 (ITGB6), partial (22-707aa), Mammalian cells expression, C-10xHis-tag - 1 mg

[0399-CSB-MP011890HU1-100UG] Recombinant Human Integrin beta-6 (ITGB6), partial (22-707aa), Mammalian cells expression, C-10xHis-tag - 100 ug

Recombinant Human Integrin beta-6 (ITGB6), partial (22-707aa), Mammalian cells expression, C-10xHis-tag - 100 ug

[0399-CSB-EP615661HUg10-20UG] Recombinant Human Protein flightless-1 homolog (FLII), partial (495-827aa), N-MBP-tag and C-6xHis-Avi-tag, E. coli expression - 20 ug

Recombinant Human Protein flightless-1 homolog (FLII), partial (495-827aa), N-MBP-tag and C-6xHis-Avi-tag, E. coli expression - 20 ug

[0399-CSB-EP615661HU-5MG] Recombinant Human Protein flightless-1 homolog (FLII), partial, E.coli expression - 5 mg

Recombinant Human Protein flightless-1 homolog (FLII), partial, E.coli expression - 5 mg

[0901-T-509-10] Recombinant Human Transthyretin (F87M/L110M) - 1 mg

Recombinant Human Transthyretin (F87M/L110M) - 1 mg

[0399-CSB-EP319334HIS-1MG] Recombinant Human adenovirus F serotype 41 Hexon protein (L3), partial (609-925aa), N-10xHis-SUMO-tag + C-Myc-tag, E.coli expression - 1 mg

Recombinant Human adenovirus F serotype 41 Hexon protein (L3), partial (609-925aa), N-10xHis-SUMO-tag + C-Myc-tag, E.coli expression - 1 mg

[0399-CSB-EP319334HIS-100UG] Recombinant Human adenovirus F serotype 41 Hexon protein (L3), partial (609-925aa), N-10xHis-SUMO-tag + C-Myc-tag, E.coli expression - 100 ug

Recombinant Human adenovirus F serotype 41 Hexon protein (L3), partial (609-925aa), N-10xHis-SUMO-tag + C-Myc-tag, E.coli expression - 100 ug

[0399-CSB-EP319334HIS-20UG] Recombinant Human adenovirus F serotype 41 Hexon protein (L3), partial (609-925aa), N-10xHis-SUMO-tag + C-Myc-tag, E.coli expression - 20 ug

Recombinant Human adenovirus F serotype 41 Hexon protein (L3), partial (609-925aa), N-10xHis-SUMO-tag + C-Myc-tag, E.coli expression - 20 ug

[0513-DAG-WT400] Recombinant Marburg virus (Musoke) Glycoprotein minus the Transmembrane Region, His-tagged - 100 ug

Recombinant Marburg virus (Musoke) Glycoprotein minus the Transmembrane Region, His-tagged - 100 ug

[0399-CSB-EP001666MO-1MG] Recombinant Mouse Anti-Muellerian hormone (Amh), partial (450-552aa), E. coli expression - 1 mg

Recombinant Mouse Anti-Muellerian hormone (Amh), partial (450-552aa), E. coli expression - 1 mg

[0399-CSB-MP001666MO-1MG] Recombinant Mouse Anti-Muellerian hormone (Amh), partial (450-552aa), Mammalian cells expression - 1 mg

Recombinant Mouse Anti-Muellerian hormone (Amh), partial (450-552aa), Mammalian cells expression - 1 mg

[0399-CSB-YP001666MO-1MG] Recombinant Mouse Anti-Muellerian hormone (Amh), partial (450-552aa), Yeast expression - 1 mg

Recombinant Mouse Anti-Muellerian hormone (Amh), partial (450-552aa), Yeast expression - 1 mg

[0399-CSB-EP717267MO-100UG] Recombinant Mouse Cochlin (Coch), 27-552aa (full length of mature protein), E.coli expression - 100 ug

Recombinant Mouse Cochlin (Coch), 27-552aa (full length of mature protein), E.coli expression - 100 ug

[0399-CSB-MP872835MO-1MG] Recombinant Mouse Netrin-4 (Ntn4), full length, mammalian cells expression - 1 mg

Recombinant Mouse Netrin-4 (Ntn4), full length, mammalian cells expression - 1 mg

[0399-CSB-MP872835MO-100UG] Recombinant Mouse Netrin-4 (Ntn4), full length, mammalian cells expression - 100 ug

Recombinant Mouse Netrin-4 (Ntn4), full length, mammalian cells expression - 100 ug

[0399-CSB-MP872835MO-20UG] Recombinant Mouse Netrin-4 (Ntn4), full length, mammalian cells expression - 20 ug

Recombinant Mouse Netrin-4 (Ntn4), full length, mammalian cells expression - 20 ug

[0399-CSB-EP878097MO-100UG] Recombinant Mouse Sodium/myo-inositol cotransporter (Slc5a3), partial (533-695aa), E. coli expression - 100 ug

Recombinant Mouse Sodium/myo-inositol cotransporter (Slc5a3), partial (533-695aa), E. coli expression - 100 ug

[0544-MBS1437468-02MG-ECOLI] Recombinant Polyphosphate kinase (ppk), E.coli expression - 0.2 mg

Recombinant Polyphosphate kinase (ppk), E.coli expression - 0.2 mg

[0399-CSB-EP774583FFZ-100UG] Recombinant Pseudomonas putida Mandelamide hydrolase (mdlY), 1-507aa (full length), E.coli expression - 100 ug

Recombinant Pseudomonas putida Mandelamide hydrolase (mdlY), 1-507aa (full length), E.coli expression - 100 ug

[0399-CSB-EP774583FFZ-20UG] Recombinant Pseudomonas putida Mandelamide hydrolase (mdlY), 1-507aa (full length), E.coli expression - 20 ug

Recombinant Pseudomonas putida Mandelamide hydrolase (mdlY), 1-507aa (full length), E.coli expression - 20 ug

[0399-CSB-EP004937RB-100UG] Recombinant Rabbit CD40 ligand (CD40LG), partial (113-261aa), E.coli expression, N-terminal 6xHis-tag - 100 ug

Recombinant Rabbit CD40 ligand (CD40LG), partial (113-261aa), E.coli expression, N-terminal 6xHis-tag - 100 ug

[0399-CSB-EP003995RA-1MG] Recombinant Rat Complement C5 (C5), E.coli expression, N-terminal 10xHis-tag & C-terminal Myc-tag - 1 mg

Recombinant Rat Complement C5 (C5), E.coli expression, N-terminal 10xHis-tag & C-terminal Myc-tag - 1 mg

[0399-CSB-EP003995RA-100UG] Recombinant Rat Complement C5 (C5), E.coli expression, N-terminal 10xHis-tag & C-terminal Myc-tag - 100 ug

Recombinant Rat Complement C5 (C5), E.coli expression, N-terminal 10xHis-tag & C-terminal Myc-tag - 100 ug

[0399-CSB-MP867502RA-100UG] Recombinant Rat Mannan-binding lectin serine protease 2 (Masp2), Full length (20-685aa), C-10xHis-tag, Mammalian cells expression - 100 ug

Recombinant Rat Mannan-binding lectin serine protease 2 (Masp2), Full length (20-685aa), C-10xHis-tag, Mammalian cells expression - 100 ug

[0399-CSB-BP867502RA-100UG] Recombinant Rat Mannan-binding lectin serine protease 2 (Masp2), Full length (20-685aa), C-6xHis-tag, Baculovirus expression - 100 ug

Recombinant Rat Mannan-binding lectin serine protease 2 (Masp2), Full length (20-685aa), C-6xHis-tag, Baculovirus expression - 100 ug

[0399-CSB-CF361018SHZb2-100UG] Recombinant Sindbis virus Structural polyprotein, partial (807-1245aa), N-terminal 10xHis-SUMO-tag - 100 ug

Recombinant Sindbis virus Structural polyprotein, partial (807-1245aa), N-terminal 10xHis-SUMO-tag - 100 ug

[0399-CSB-EP314306VBHa0-5MG] Recombinant Vesicular stomatitis Indiana virus Glycoprotein G (G), partial (1-423aa), N-6xHis-tag, E.coli expression - 5 mg

Recombinant Vesicular stomatitis Indiana virus Glycoprotein G (G), partial (1-423aa), N-6xHis-tag, E.coli expression - 5 mg

[1465-EG20003M] Ribonuclease A (RNase A) - 1 gram

Ribonuclease A (RNase A) - 1 gram

[0544-MBS1576198-5X1MG] VSV G protein/Glycoprotein G Recombinant Protein - 5x 1 mg

VSV G protein/Glycoprotein G Recombinant Protein - 5x 1 mg